.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yyu

  • We have highlighted your search term 2yyu for you. If you'd like to remove the search term, click here.
Table of contents
  1. 1. Protein Summary
  2. 2. Ligand Summary

Title Crystal structure of uncharacterized conserved protein from Geobacillus kaustophilus. To be Published
Site RSGI
PDB Id 2yyu Target Id gka001001155.2
Molecular Characteristics
Source Geobacillus kaustophilus
Alias Ids TPS12300, Molecular Weight 26943.44 Da.
Residues 246 Isoelectric Point 7.28
Sequence ghmhtpfivaldfpskqeverflrpfagtplfvkvgmelyyqegpaivaflkeqghavfldlklhdipn tvkqamkglarvgadlvnvhaaggrrmmeaaiegldagtpsgrmrprciavtqltstdermlheelwis rplvetvahyaalakesgldgvvcsaneaafikercgasflavtpgirfaddaahdqvrvvtprkaral gsdyivigrsltraadplrtyarlqhewnggeresttpt
  BLAST   FFAS

Structure Determination
Method XRAY Chains 2
Resolution (Å) 2.20 Rfree 0.272
Matthews' coefficent 2.02 Rfactor 0.214
Waters 169 Solvent Content 39.07

Ligand Information
Ligands C5P (CYTIDINE-5'-MONOPHOSPHATE) x 2
Metals

Jmol

 

Protein Summary

 

Ligand Summary

Reviews

References

 

No references found.

Tag page
  • No tags

Files (0)

 
You must login to post a comment.
All content on this site is licensed under a Creative Commons Attribution 3.0 License
Powered by MindTouch