.
The Open Protein Structure Annotation Network
PDB Keyword
.

430694

    This page can't be edited.
    Table of contents
    to the older version or return to version archive.

    Combined revision comparison

    Comparing version 00:33, 21 Nov 2014 by Admin with version 00:33, 21 Nov 2014 by Admin.
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Crystallized',This is a dummy page. date:"2014-11-13", targetid:"430694", pdbid:"", source:"Clostridium sporogenes atcc 15579", relatedPDBs:[], refids:"ZP_02995892.1", molwt:"26876.49", residues:"238", isopoint:"6.93", sequence:"inedeipsviknntvknlddvknldkissleiidsgiehidklkgkeniktlkivhcnikdleiistlk nlenleiidcnlndvsivknlkqlkrldisnnqignlkgienltnlkelymsnnnitniepmcsllklt nldisdnkinnikelknmksikelnicnnnisslegienmgqlvglwtsnnkinnvsilsnkneivnls ldnnkisdisvisnfkklkslkldknnisny", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    Protein Summary


    Ligand Summary


    Version from 00:33, 21 Nov 2014

    This revision modified by Admin (Ban)

    This is a dummy page.


    Current version

    This revision modified by Admin (Ban)
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Crystallized', date:"2014-11-13", targetid:"430694", pdbid:"", source:"Clostridium sporogenes atcc 15579", relatedPDBs:[], refids:"ZP_02995892.1", molwt:"26876.49", residues:"238", isopoint:"6.93", sequence:"inedeipsviknntvknlddvknldkissleiidsgiehidklkgkeniktlkivhcnikdleiistlk nlenleiidcnlndvsivknlkqlkrldisnnqignlkgienltnlkelymsnnnitniepmcsllklt nldisdnkinnikelknmksikelnicnnnisslegienmgqlvglwtsnnkinnvsilsnkneivnls ldnnkisdisvisnfkklkslkldknnisny", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    Protein Summary


    Ligand Summary


    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch