.
The Open Protein Structure Annotation Network
PDB Keyword
.

424721

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Version as of 01:43, 23 May 2013

    to this version.

    Return to Version archive.

    View current version

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 424721
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS73756,GATA4_HUMAN_OPTIMIZED Molecular Weight 14810.31 Da.
    Residues 133 Isoelectric Point 9.95
    Sequence mfddfsegrecvncgamstplwrrdgtghylcnacglyhkmnginrplikpqrrlsasrrvglscancq tttttlwrrnaegepvcnacglymklhgvprplamrkegiqtrkrkpknlnksktpaapsgses
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch