.
The Open Protein Structure Annotation Network
PDB Keyword
.

424087

    This page can't be edited.
    Table of contents
    You are currently comparing two old versions - only when you are comparing against the latest version can you revert. Return to version archive.

    Combined revision comparison

    Comparing version 18:42, 24 May 2012 by Admin with version 22:37, 14 Jun 2012 by Admin.
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction', date:"2012-05-0803", targetid:"424087", pdbid:"", source:"Homo sapiens", relatedPDBs:[], refids:"SGT82680", molwt:"10158.23", residues:"84", isopoint:"10.51", sequence:"ssknkphvkrpmnafmvwaqaarrkladqyphlhnaelsktlgklwrllnesekrpfveeaerlrvqhk kdhpdykyqprrrks", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...


    ...


    Version from 18:42, 24 May 2012

    This revision modified by Admin (Ban)
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction', date:"2012-05-03", targetid:"424087", pdbid:"", source:"Homo sapiens", relatedPDBs:[], refids:"SGT82680", molwt:"10158.23", residues:"84", isopoint:"10.51", sequence:"ssknkphvkrpmnafmvwaqaarrkladqyphlhnaelsktlgklwrllnesekrpfveeaerlrvqhk kdhpdykyqprrrks", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...


    ...


    Version as of 22:37, 14 Jun 2012

    This revision modified by Admin (Ban)
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction', date:"2012-05-08", targetid:"424087", pdbid:"", source:"Homo sapiens", relatedPDBs:[], refids:"SGT82680", molwt:"10158.23", residues:"84", isopoint:"10.51", sequence:"ssknkphvkrpmnafmvwaqaarrkladqyphlhnaelsktlgklwrllnesekrpfveeaerlrvqhk kdhpdykyqprrrks", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...


    ...


    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch