.
The Open Protein Structure Annotation Network
PDB Keyword
.

422868

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Version as of 07:41, 22 May 2013

    to this version.

    Return to Version archive.

    View current version

    Site JCSG Biology Target:
    Status Crystal Structure
    Target Id 422868
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS67084,BC094795 Molecular Weight 9619.12 Da.
    Residues 85 Isoelectric Point 4.66
    Sequence msaegyqyralydykkereedidlhlgdiltvnkgslvalgfsdgqearpeeigwlngynettgergdf pgtyveyigrkkispp
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch