.
The Open Protein Structure Annotation Network
PDB Keyword
.

422851

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Version as of 11:51, 18 May 2013

    to this version.

    Return to Version archive.

    View current version

    Site JCSG Biology Target:
    Status Diffraction-quality Crystals
    Target Id 422851
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS72344,BC091514 Molecular Weight 9813.64 Da.
    Residues 86 Isoelectric Point 7.11
    Sequence pikpptyqvleygeavaqytfkgdlevelsfrkgehiclirkvnenwyegritgtgrqgifpasyvqvs reprlrlcddgpqlpts
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch