.
The Open Protein Structure Annotation Network
PDB Keyword
.

420480

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Version as of 21:28, 19 May 2013

    to this version.

    Return to Version archive.

    View current version

    Site JCSG
    Status Crystallized
    Target Id 420480
    Molecular Characteristics
    Source Acinetobacter baumannii aye
    Alias Ids TPS74655,YP_001712659.1 Molecular Weight 25510.70 Da.
    Residues 228 Isoelectric Point 7.21
    Sequence evksftphfpkfyssaatrkadnqfyplgeakflngvtvpfygvtaqsptengllkdfeictpkscrfn fkieaqhakqlkllalpetglvlvpqswhdvqanagangtgfalimspdqkqaielydssfcvgcglpn atlyfpellkesleneyggfkdpknlinivhpskkvaffsyqipqvnnkthgiakyddkdtfnykeiqv tldksqqflvgpilnfynath
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch