.
The Open Protein Structure Annotation Network
PDB Keyword
.

418974

    This page can't be edited.
    Table of contents
    You are currently comparing two old versions - only when you are comparing against the latest version can you revert. Return to version archive.

    Combined revision comparison

    Comparing version 23:24, 9 Dec 2014 by haxelrod with version 23:33, 9 Dec 2014 by haxelrod.
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Crystal Structure', date:"2014-10-23", targetid:"418974", pdbid:"", source:"Bacillus subtilis subsp. subtilis str. 168", relatedPDBs:[], refids:"NP_389097.1", molwt:"17727.84", residues:"159", isopoint:"5.47", sequence:"aaqtntlsentnqsaaelvknlyntaykgempqqaqgltinkstkgdvhaafgeperpvggdnrfdlyh wnmgqpgygfsyhkdmtiseiryfgtgverqlnlggvtpevlqkqlgpvnrvltvpftdeidyvydtgr yelhfvigtdqtadhvnlkak", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...

    PDB ID DALI Z-score rmsd (Ang) length of alignment number of residues % sequence id Description
    4ifa 8.4 2.8 106 298 11 1.5 Angstrom resolution crystal structure of an extracellular protein containing a SCP domain from Bacillus anthracis str. Ames
    2qzb 8.4 3.3 113 147 11 Crystal structure of the uncharacterized protein yfeY from Escherichia coli
    4h0a 8.2 3.5 113 301 12 Crystal structure of a hypothetical protein (SAV1118) from Staphylococcus aureus subsp. aureus Mu50 at 1.90 A resolution
    3gmy 7.2 4.1 80 154 10 Crystal Structure of Beta-Lactamse Inhibitory Protein-Like Protein (BLP), Selenomethionine Derivative[Ref]
    3d4e 7.1 5.4 84 162 6 Crystal structure of putative beta-lactamase inhibitor protein (NP_721579.1) from STREPTOCOCCUS MUTANS at 1.40 A resolution
     3gmv  7.1  2.9  61  258  18  Crystal Structure of Beta-Lactamse Inhibitory Protein-I (BLIP-I) in Apo Form [Ref]
     3e2l  7.1  5.1  85  160  8  Helicobacter pylori formamidase AmiF contains a fine-tuned cysteine-glutamate-lysine catalytic triad[Ref]
                 
                 

    ...

    The structure

    ...


    Other changes:

    1. /body/p[5]/a/@class: " external""external"

    Version from 23:24, 9 Dec 2014

    This revision modified by haxelrod (Ban)
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Crystal Structure', date:"2014-10-23", targetid:"418974", pdbid:"", source:"Bacillus subtilis subsp. subtilis str. 168", relatedPDBs:[], refids:"NP_389097.1", molwt:"17727.84", residues:"159", isopoint:"5.47", sequence:"aaqtntlsentnqsaaelvknlyntaykgempqqaqgltinkstkgdvhaafgeperpvggdnrfdlyh wnmgqpgygfsyhkdmtiseiryfgtgverqlnlggvtpevlqkqlgpvnrvltvpftdeidyvydtgr yelhfvigtdqtadhvnlkak", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...


    Version as of 23:33, 9 Dec 2014

    This revision modified by haxelrod (Ban)
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Crystal Structure', date:"2014-10-23", targetid:"418974", pdbid:"", source:"Bacillus subtilis subsp. subtilis str. 168", relatedPDBs:[], refids:"NP_389097.1", molwt:"17727.84", residues:"159", isopoint:"5.47", sequence:"aaqtntlsentnqsaaelvknlyntaykgempqqaqgltinkstkgdvhaafgeperpvggdnrfdlyh wnmgqpgygfsyhkdmtiseiryfgtgverqlnlggvtpevlqkqlgpvnrvltvpftdeidyvydtgr yelhfvigtdqtadhvnlkak", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...

    PDB ID DALI Z-score rmsd (Ang) length of alignment number of residues % sequence id Description
    4ifa 8.4 2.8 106 298 11 1.5 Angstrom resolution crystal structure of an extracellular protein containing a SCP domain from Bacillus anthracis str. Ames
    2qzb 8.4 3.3 113 147 11 Crystal structure of the uncharacterized protein yfeY from Escherichia coli
    4h0a 8.2 3.5 113 301 12 Crystal structure of a hypothetical protein (SAV1118) from Staphylococcus aureus subsp. aureus Mu50 at 1.90 A resolution
    3gmy 7.2 4.1 80 154 10 Crystal Structure of Beta-Lactamse Inhibitory Protein-Like Protein (BLP), Selenomethionine Derivative[Ref]
    3d4e 7.1 5.4 84 162 6 Crystal structure of putative beta-lactamase inhibitor protein (NP_721579.1) from STREPTOCOCCUS MUTANS at 1.40 A resolution
    3gmv 7.1 2.9 61 258 18 Crystal Structure of Beta-Lactamse Inhibitory Protein-I (BLIP-I) in Apo Form [Ref]
    3e2l 7.1 5.1 85 160 8 Helicobacter pylori formamidase AmiF contains a fine-tuned cysteine-glutamate-lysine catalytic triad[Ref]
                 
                 

    ...

    The structure

    ...


    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch