.
The Open Protein Structure Annotation Network
PDB Keyword
.

2mu1

    This page can't be edited.
    Table of contents
    to the older version or return to version archive.

    Combined revision comparison

    Comparing version 00:33, 21 Nov 2014 by Admin with version 00:33, 21 Nov 2014 by Admin.
    {{ template.Protein{ leadContact:"", title:"NMR structure of the core domain of NP_346487.1, a putative phosphoglycolateThis is a dummy page. phosphatase from Streptococcus pneumoniae TIGR4. To be Published",site:'JCSG', status:'In PDB', date:"2014-09-03", targetid:"430697", pdbid:"2mu1", source:"Streptococcus pneumoniae tigr4", relatedPDBs:[], refids:"NP_346487.1", molwt:"13807.62", residues:"122", isopoint:"4.77", sequence:"lmpgarevlawadesgiqqfiythkgnnaftilkdlgvesyfteiltsqsgfvrkpspeaatylldkyq lnsdntyyigdrtldvefaqnsgiqsinflestyegnhriqaladisrifetk", method:"NMR", numchains:"1", resolution:"not", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"Q97NG6", pubmed:"" } }}

    Protein Summary


    Ligand Summary


    Version from 00:33, 21 Nov 2014

    This revision modified by Admin (Ban)

    This is a dummy page.


    Current version

    This revision modified by Admin (Ban)
    {{ template.Protein{ leadContact:"", title:"NMR structure of the core domain of NP_346487.1, a putative phosphoglycolate phosphatase from Streptococcus pneumoniae TIGR4. To be Published",site:'JCSG', status:'In PDB', date:"2014-09-03", targetid:"430697", pdbid:"2mu1", source:"Streptococcus pneumoniae tigr4", relatedPDBs:[], refids:"NP_346487.1", molwt:"13807.62", residues:"122", isopoint:"4.77", sequence:"lmpgarevlawadesgiqqfiythkgnnaftilkdlgvesyfteiltsqsgfvrkpspeaatylldkyq lnsdntyyigdrtldvefaqnsgiqsinflestyegnhriqaladisrifetk", method:"NMR", numchains:"1", resolution:"not", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"Q97NG6", pubmed:"" } }}

    Protein Summary


    Ligand Summary


    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch