| Title | Crystal structure of the response regulatory protein PrrA from Mycobacterium Tuberculosis. To be published | | Site | XMTB | | PDB Id | | Target Id | rv0903c | | Related PDB Ids 1ys7 | | Molecular Characteristics | | Source | Mycobacterium tuberculosis h37rv | | Alias Ids | TPS12005, | Molecular Weight | 25252.48 Da. | | Residues | 236 | Isoelectric Point | 4.97 | | Sequence | mggmdtgvtsprvlvvdddsdvlaslerglrlsgfevatavdgaealrsatenrpdaivldinmpvldg vsvvtalramdndvpvcvlsarssvddrvagleagaddylvkpfvlaelvarvkallrrrgstatssse titvgplevdipgrrarvngvdvdltkrefdllavlaehktavlsraqllelvwgydfaadtnvvdvfi gylrrkleagggprllhtvrgvgfvlrmq | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.77 | Rfree | 0.24738 | | Matthews' coefficent | 2.18 | Rfactor | 0.1879 | | Waters | 340 | Solvent Content | 43.58 |
| Ligand Information | | Ligands | GOL (GLYCEROL) x 1 | | Metals | CA (CALCIUM) x 2 | | |
