.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ys6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Crystal structure of the response regulatory protein PrrA from Mycobacterium Tuberculosis. To be published
    Site XMTB
    PDB Id 1ys6 Target Id rv0903c
    Related PDB Ids 1ys7 
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS12005, Molecular Weight 25252.48 Da.
    Residues 236 Isoelectric Point 4.97
    Sequence mggmdtgvtsprvlvvdddsdvlaslerglrlsgfevatavdgaealrsatenrpdaivldinmpvldg vsvvtalramdndvpvcvlsarssvddrvagleagaddylvkpfvlaelvarvkallrrrgstatssse titvgplevdipgrrarvngvdvdltkrefdllavlaehktavlsraqllelvwgydfaadtnvvdvfi gylrrkleagggprllhtvrgvgfvlrmq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.77 Rfree 0.24738
    Matthews' coefficent 2.18 Rfactor 0.1879
    Waters 340 Solvent Content 43.58

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals CA (CALCIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch