| Title | The structure of dihydrodipicolinate reductase (DapB) from Mycobacterium tuberculosis in three crystal forms. Acta Crystallogr.,Sect.D 66 61-72 2010 | | Site | TBSGC | | PDB Id | | Target Id | Rv2773c | | Related PDB Ids 1c3v 1p9l 1yl5 1yl7 | | Molecular Characteristics | | Source | | | Alias Ids | TPS12010,15609910, P72024, 15609910, NP_217289.1 | Molecular Weight | 25731.92 Da. | | Residues | 245 | Isoelectric Point | 5.51 | | Sequence | mrvgvlgakgkvgatmvravaaaddltlsaeldagdplslltdgntevvidfthpdvvmgnleflidng ihavvgttgftaerfqqveswlvakpntsvliapnfaigavlsmhfakqaarffdsaevielhhphkad apsgtaartakliaearkglppnpdatstslpgargadvdgipvhavrlaglvahqevlfgtegetlti rhdsldrtsfvpgvllavrriaerpgltvgleplldlh | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.90 | Rfree | 0.25689 | | Matthews' coefficent | 2.90 | Rfactor | 0.19883 | | Waters | 2 | Solvent Content | 57.80 |
| Ligand Information | | Ligands | | | Metals | MG (MAGNESIUM) x 2 | | |