| Title | Crystal structure and kinetic study of dihydrodipicolinate synthase from Mycobacterium tuberculosis. Biochem.J. 411 351-360 2008 | | Site | TBSGC | | PDB Id | | Target Id | Rv2753c | | Molecular Characteristics | | Source | | | Alias Ids | TPS12008,15609890, P63945, 15609890, NP_217269.1 | Molecular Weight | 30856.38 Da. | | Residues | 300 | Isoelectric Point | 5.45 | | Sequence | mttvgfdvaarlgtlltamvtpfsgdgsldtataarlanhlvdqgcdglvvsgttgesptttdgekiel lravleavgdrarviagagtydtahsirlakacaaegahgllvvtpyyskppqrglqahftavadatel pmllydipgrsavpiepdtiralashpnivgvkdakadlhsgaqimadtglayysgddalnlpwlamga tgfisviahlaagqlrellsafgsgdiatarkiniavaplcnamsrlggvtlskaglrlqgidvgdprl pqvaatpeqidalaadmraasvlr | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 8 | | Resolution (Å) | 2.28 | Rfree | 0.215 | | Matthews' coefficent | 2.08 | Rfactor | 0.148 | | Waters | 1587 | Solvent Content | 40.32 |
| Ligand Information | | Ligands | DTT (2,3-DIHYDROXY-1,4-DITHIOBUTANE) x 8 | | Metals | MG (MAGNESIUM) x 8;CL (CHLORIDE) x 8 | | |
