| Title | The High Resolution Structure of Leub (Rv2995C) from Mycobacterium Tuberculosis. J.Mol.Biol. 346 1 2005 | | Site | XMTB | | PDB Id | | Target Id | rv2995c | | Molecular Characteristics | | Source | Mycobacterium tuberculosis h37rv | | Alias Ids | TPS12012, | Molecular Weight | 35304.04 Da. | | Residues | 336 | Isoelectric Point | 5.44 | | Sequence | mklaiiagdgigpevtaeavkvldavvpgvqktsydlgarrfhatgevlpdsvvaelrnhdaillgaig dpsvpsgvlerglllrlrfeldhhinlrparlypgvasplsgnpgidfvvvregtegpytgnggairvg tpnevatevsvntafgvrrvvadaferarrrrkhltlvhktnvltfagglwlrtvdevgecypdvevay qhvdaatihmitdpgrfdvivtdnlfgdiitdlaaavcggiglaasgnidatranpsmfepvhgsapdi agqgiadptaaimsvalllshlgehdaaarvdraveahlatrgserlatsdvgeriaaal | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 1.65 | Rfree | 0.241 | | Matthews' coefficent | 2.44 | Rfactor | 0.213 | | Waters | 579 | Solvent Content | 49.6 |
| Ligand Information | | Ligands | SO4 (SULFATE) x 1 | | Metals | | | |
