| Title | Structures of Mycobacterium tuberculosispyridoxine 5'-phosphate oxidase and its complexes with flavin mononucleotide and pyridoxal 5'-phosphate. Acta Crystallogr.,Sect.D 61 1492-1499 2005 | | Site | TBSGC | | PDB Id | | Target Id | Rv1155 | | Related PDB Ids 1xxo 1w9a 1y30 | | Molecular Characteristics | | Source | Mycobacterium tuberculosis h37rv | | Alias Ids | TPS9449,15608295, O06553, 15608295, NP_215671.1 | Molecular Weight | 16299.58 Da. | | Residues | 147 | Isoelectric Point | 6.05 | | Sequence | marqvfddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrnlrrdprasi lvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddyrqamvtdrrvlltlpish vyglppgmr | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.70 | Rfree | 0.194 | | Matthews' coefficent | 2.20 | Rfactor | 0.191 | | Waters | 379 | Solvent Content | 44.00 |
| Ligand Information | | Ligands | PLP (PYRIDOXAL-5'-PHOSPHATE) x 1 | | Metals | | | |
