| Title | Probing the Mechanism of the Mycobacterium tuberculosis beta-Ketoacyl-Acyl Carrier Protein Synthase III mtFabH: Factors Influencing Catalysis And Substrate Specificity. J.Biol.Chem. 280 32539-32547 2005 | | Site | TBSGC | | PDB Id | | Target Id | Rv0533c | | Related PDB Ids 1hzp 1m1m 2ahb | | Molecular Characteristics | | Source | | | Alias Ids | TPS9438,15607673, P0A574, 15607673, NP_215047.1 | Molecular Weight | 34870.46 Da. | | Residues | 335 | Isoelectric Point | 4.98 | | Sequence | mteiattsgarsvgllsvgayrpervvtndeicqhidssdewiytrtgiktrrfaaddesaasmateac rralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsagcagfgyalgaaadmirg ggaatmlvvgteklsptidmydrgncfifadgaaavvvgetpfqgigptvagsdgeqadairqdidwit faqnpsgprpfvrlegpavfrwaafkmgdvgrramdaagvrpdqidvfvphqansrinellvknlqlrp davvandiehtgntsaasiplamaellttgaakpgdlalligygaglsyaaqvvrmpkg | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.50 | Rfree | 0.279 | | Matthews' coefficent | 2.30 | Rfactor | 0.225 | | Waters | 101 | Solvent Content | 45.30 |
| Ligand Information | | Ligands | | | Metals | | | |
