| Title | Crystal Structure of the Pantothenate Synthetase from Mycobacterium tuberculosis, Snapshots of the Enzyme in Action. Biochemistry 45 1554-1561 2006 | | Site | TBSGC | | PDB Id | | Target Id | Rv3602c | | Related PDB Ids 1mop 1n2b 1n2e 1n2g 1n2h 1n2i 1n2j 1n2o 2a84 2a86 2a7x | | Molecular Characteristics | | Source | | | Alias Ids | TPS20722,15610738, P0A5R0, 15610738, NP_218119.1 | Molecular Weight | 32675.60 Da. | | Residues | 309 | Isoelectric Point | 5.70 | | Sequence | mtipafhpgelnvysapgdvadvsralrltgrrvmlvptmgalheghlalvraakrvpgsvvvvsifvn pmqfgagedldayprtpdddlaqlraegveiaftpttaamypdglrttvqpgplaaeleggprpthfag vltvvlkllqivrpdrvffgekdyqqlvlirqlvadfnldvavvgvptvreadglamssrnryldpaqr aaavalsaaltaaahaatagaqaaldaaravldaapgvavdylelrdiglgpmplngsgrllvaarlgt trlldniaieigtfagtdrpdgyraileshwrn | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.70 | Rfree | 0.186 | | Matthews' coefficent | 2.87 | Rfactor | 0.152 | | Waters | 287 | Solvent Content | 57.20 |
| Ligand Information | | Ligands | SO4 (SULFATE) x 1;GOL (GLYCEROL) x 2 | | Metals | | | |
