| Title | Conformational flexibility of Mycobacterium tuberculosis thioredoxin reductase: crystal structure and normal-mode analysis. Acta Crystallogr.,Sect.D 61 1603-1611 2005 | | Site | TBSGC | | PDB Id | | Target Id | Rv3913 | | Molecular Characteristics | | Source | | | Alias Ids | TPS20798,15611049, P52214, 15611049, NP_218430.1 | Molecular Weight | 35641.02 Da. | | Residues | 335 | Isoelectric Point | 5.30 | | Sequence | mtappvhdrahhpvrdvivigsgpagytaalyaaraqlaplvfegtsfggalmtttdvenypgfrngit gpelmdemreqalrfgadlrmedvesvslhgplksvvtadgqthraravilamgaaarylqvpgeqell grgvsscatcdgfffrdqdiavigggdsameeatfltrfarsvtlvhrrdefraskimldrarnndkir fltnhtvvavdgdttvtglrvrdtntgaettlpvtgvfvaigheprsglvreaidvdpdgyvlvqgrtt stslpgvfaagdlvdrtyrqavtaagsgcaaaidaerwlaehaatgeadstdaligaqr | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 3.00 | Rfree | 0.29066 | | Matthews' coefficent | 2.50 | Rfactor | 0.21132 | | Waters | 16 | Solvent Content | 51.40 |
| Ligand Information | | Ligands | FAD (FLAVIN-ADENINE) x 2;NAP (NADP) x 2 | | Metals | MG (MAGNESIUM) x 2 | | |
