| Title | Solution structure of the conserved hypothetical protein Rv2302 from Mycobacterium tuberculosis. J.Bacteriol. 188 5993-6001 2006 | | Site | TBSGC | | PDB Id | | Target Id | Rv2302 | | Molecular Characteristics | | Source | | | Alias Ids | TPS20684,15609439, P64983, NP_216818.1 | Molecular Weight | 8590.08 Da. | | Residues | 80 | Isoelectric Point | 6.02 | | Sequence | mhakvgdylvvkgttterhdqhaeiievrsadgsppyvvrwlvnghettvypgsdavvvtatehaeaek raaaraghaat | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
