| Title | Structural and Functional Analysis of Rv3214 from Mycobacterium tuberculosis, a Protein with Conflicting Functional Annotations, Leads to Its Characterization as a Phosphatase. J.Bacteriol. 188 3589-3599 2006 | | Site | TBSGC | | PDB Id | | Target Id | Rv3214 | | Molecular Characteristics | | Source | | | Alias Ids | TPS20715,57117074, Q6MWZ7, 57117074, Q6MWZ7, YP_177944.1 | Molecular Weight | 21947.62 Da. | | Residues | 203 | Isoelectric Point | 5.54 | | Sequence | mgvrnhrllllrhgetawstlgrhtggteveltdtgrtqaelagqllgelelddpivicsprrrtldta klagltvnevtgllaewdygsyeglttpqiresepdwlvwthgcpagesvaqvndradsavalalehms srdvlfvshghfsravitrwvqlplaegsrfamptasigicgfehgvrqlavlgltghpqpiaag | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.20 | Rfree | 0.226 | | Matthews' coefficent | 2.00 | Rfactor | 0.209 | | Waters | 106 | Solvent Content | 37.70 |
| Ligand Information | | Ligands | SO4 (SULFATE) x 2;GOL (GLYCEROL) x 2 | | Metals | | | |
