| Title | Modification of the NADH of the isoniazid target (InhA) from Mycobacterium tuberculosis. Science 279 98-102 1998 | | Site | TBSGC | | PDB Id | | Target Id | Rv1484 | | Related PDB Ids 1enz 1eny 1bvr 1p44 1p45 2aq8 2b35 2b36 2b37 2h7i 2h7l 2h7m 2h7n 2h7p 2nv6 | | Molecular Characteristics | | Source | | | Alias Ids | TPS9460,15608622, P0A5Y6, 15608622, NP_216000.1 | Molecular Weight | 28526.21 Da. | | Residues | 269 | Isoelectric Point | 5.73 | | Sequence | mtglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakaplleldvqnee hlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgihisaysyasmakallpim npggsivgmdfdpsrampaynwmtvaksalesvnrfvareagkygvrsnlvaagpirtlamsaivggal geeagaqiqlleegwdqrapigwnmkdatpvaktvcallsdwlpattgdiiyadggahtqll | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.70 | Rfree | 0.2970000 | | Matthews' coefficent | 3.58 | Rfactor | 0.2020000 | | Waters | 68 | Solvent Content | 65.60 |
| Ligand Information | | Ligands | ZID (ISONICOTINIC-ACETYL-NICOTINAMIDE-ADENINE) x 1 | | Metals | | | |
