| Title | The crystal structure of Rv1347c, a putative antibiotic resistance protein from Mycobacterium tuberculosis, reveals a GCN5-related fold and suggests an alternative function in siderophore biosynthesis. J.Biol.Chem. 280 13978-13986 2005 | | Site | TBSGC | | PDB Id | | Target Id | Rv1347c | | Molecular Characteristics | | Source | | | Alias Ids | TPS9455,15608487, P64819, NP_215863.1 | Molecular Weight | 23797.67 Da. | | Residues | 210 | Isoelectric Point | 6.38 | | Sequence | mtkptsagqaddalvrlarerfdlpdqvrrlarppvpsleppyglrvaqltdaemlaewmnrphlaaaw eydwpasrwrqhlnaqlegtyslpligswhgtdggylelywaakdlishyydadpydlglhaaiadlsk vnrgfgplllprivasvfaneprcrrimfdpdhrntatrrlcewagckflgehdttnrrmalyaleapt taa | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 8 | | Resolution (Å) | 2.20 | Rfree | 0.258 | | Matthews' coefficent | 2.40 | Rfactor | 0.227 | | Waters | 650 | Solvent Content | 51.00 |
| Ligand Information | | Ligands | BOG (B-OCTYLGLUCOSIDE) x 3 | | Metals | | | |
