| Title | The 1.25 A resolution structure of phosphoribosyl-ATP pyrophosphohydrolase from Mycobacterium tuberculosis. Acta Crystallogr.,Sect.D 64 627-635 2008 | | Site | TBSGC | | PDB Id | | Target Id | Rv2122c | | Molecular Characteristics | | Source | Mycobacterium tuberculosis h37rv | | Alias Ids | TPS27518,57116947, P0A5B1, 57116947, YP_177860.1 | Molecular Weight | 10274.03 Da. | | Residues | 93 | Isoelectric Point | 4.63 | | Sequence | mqqslavktfedlfaelgdrartrpadsttvaaldggvhalgkklleeagevwlaaehesndalaeeis qllywtqvlmisrglslddvyrkl | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.25 | Rfree | 0.20747 | | Matthews' coefficent | 2.50 | Rfactor | 0.18336 | | Waters | 151 | Solvent Content | 37.00 |
| Ligand Information | | Ligands | | | Metals | | | |
