| Title | NAD-binding mode and the significance of intersubunit contact revealed by the crystal structure of Mycobacterium tuberculosis NAD kinase-NAD complex. Biochem.Biophys.Res.Commun. 327 500-508 2005 | | Site | TBSGC | | PDB Id | | Target Id | Rv1695 | | Related PDB Ids 1u0r 1u0t 1y3h | | Molecular Characteristics | | Source | | | Alias Ids | TPS20532,15608833, P0A5S6, 15608833, O33196, NP_216211.1 | Molecular Weight | 32901.84 Da. | | Residues | 307 | Isoelectric Point | 5.26 | | Sequence | mtahrsvllvvhtgrdeatetarrvekvlgdnkialrvlsaeavdrgslhlapddmramgveievvdad qhaadgcelvlvlggdgtflraaelarnasipvlgvnlgrigflaeaeaeaidavlehvvaqdyrvedr ltldvvvrqggrivnrgwalnevslekgprlgvlgvvveidgrpvsafgcdgvlvstptgstayafsag gpvlwpdleailvvpnnahalfgrpmvtspeatiaieieadghdalvfcdgrremlipagsrlevtrcv tsvkwarldsapftdrlvrkfrlpvtgwrgk | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.60 | Rfree | 0.215 | | Matthews' coefficent | 2.79 | Rfactor | | | Waters | 43 | Solvent Content | 55.50 |
| Ligand Information | | Ligands | NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 2;GOL (GLYCEROL) x 4;SO4 (SULFATE) x 1 | | Metals | | | |