.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y25

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Structure of the inactive variant C60S of Mycobacterium tuberculosis thiol peroxidase. Acta Crystallogr.,Sect.D 62 563-567 2006
    Site TBSGC
    PDB Id 1y25 Target Id Rv1932
    Related PDB Ids 1xvq 
    Molecular Characteristics
    Source
    Alias Ids TPS20665,15609069, P66952, 15609069, NP_216448.1 Molecular Weight 16895.12 Da.
    Residues 165 Isoelectric Point 4.37
    Sequence maqitlrgnaintvgelpavgspapaftltggdlgvissdqfrgksvllnifpsvdtpvcatsvrtfde raaasgatvlcvskdlpfaqkrfcgaegtenvmpasafrdsfgedygvtiadgpmagllaraivvigad gnvaytelvpeiaqepnyeaalaalga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.2493
    Matthews' coefficent 3.14 Rfactor 0.17076
    Waters 368 Solvent Content 60.78

    Ligand Information
    Ligands ACT (ACETATE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch