| Title | Structure of the inactive variant C60S of Mycobacterium tuberculosis thiol peroxidase. Acta Crystallogr.,Sect.D 62 563-567 2006 | | Site | TBSGC | | PDB Id | | Target Id | Rv1932 | | Related PDB Ids 1xvq | | Molecular Characteristics | | Source | | | Alias Ids | TPS20665,15609069, P66952, 15609069, NP_216448.1 | Molecular Weight | 16895.12 Da. | | Residues | 165 | Isoelectric Point | 4.37 | | Sequence | maqitlrgnaintvgelpavgspapaftltggdlgvissdqfrgksvllnifpsvdtpvcatsvrtfde raaasgatvlcvskdlpfaqkrfcgaegtenvmpasafrdsfgedygvtiadgpmagllaraivvigad gnvaytelvpeiaqepnyeaalaalga | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.10 | Rfree | 0.2493 | | Matthews' coefficent | 3.14 | Rfactor | 0.17076 | | Waters | 368 | Solvent Content | 60.78 |
| Ligand Information | | Ligands | ACT (ACETATE) x 2 | | Metals | | | |
