| Title | The crystal structure of Rv0793, a hypothetical monooxygenase from M. tuberculosis. J.STRUCT.FUNCT.GENOM. 6 245-257 2005 | | Site | TBSGC | | PDB Id | | Target Id | Rv0793 | | Molecular Characteristics | | Source | Mycobacterium tuberculosis h37rv | | Alias Ids | TPS9443,15607933, O86332, 15607933, NP_215308.1 | Molecular Weight | 11191.06 Da. | | Residues | 101 | Isoelectric Point | 5.61 | | Sequence | mtspvaviarfmprpdarsalralldamitptraedgcrsydlyesadggelvlferyrsrialdehrg sphylnyraqvgelltrpvavtvlapldeasa | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.60 | Rfree | 0.219 | | Matthews' coefficent | 1.84 | Rfactor | 0.173 | | Waters | 208 | Solvent Content | 33.20 |
| Ligand Information | | Ligands | ACT (ACETATE) x 3 | | Metals | | | |
