| Title | Structure of Mycobacterium tuberculosis single-stranded DNA-binding protein. Variability in quaternary structure and its implications. J.MOL.BIOL. 331 385-393 2003 | | Site | TBSGC | | PDB Id | | Target Id | Rv0054 | | Related PDB Ids 1ue1 1ue5 1ue7 | | Molecular Characteristics | | Source | | | Alias Ids | TPS9422,15607196, P0A610, 15607196, NP_214568.1 | Molecular Weight | 17352.11 Da. | | Residues | 164 | Isoelectric Point | 5.12 | | Sequence | magdttitivgnltadpelrftpsgaavanftvastpriydrqtgewkdgealflrcniwreaaenvae sltrgarvivsgrlkqrsfetregekrtvievevdeigpslryatakvnkasrsggfgsgsrpapaqts sasgddpwgsapasgsfgggddeppf | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.70 | Rfree | 0.295 | | Matthews' coefficent | 3.38 | Rfactor | 0.231 | | Waters | 229 | Solvent Content | 63.30 |
| Ligand Information | | Ligands | | | Metals | | | |
