| Title | The SAD crystal structure of Mycobacterium tuberculosis conserved hypotetical protein Rv2991. To be Published | | Site | TBSGC | | PDB Id | | Target Id | Rv2991 | | Molecular Characteristics | | Source | | | Alias Ids | TPS20713,15610128, O53240, 15610128, NP_217507.1 | Molecular Weight | 18202.75 Da. | | Residues | 163 | Isoelectric Point | 6.09 | | Sequence | mgtkqradivmseaeiadfvnssrtgtlatigpdgqphltamwyavidgeiwletkaksqkavnlrrdp rvsflledgdtydtlrgvsfegvaeiveepealhrvgvsvwerytgpytdeckpmvdqmmnkrvgvriv arrtrswdhrklglphmsvggstap | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.00 | Rfree | 0.28106 | | Matthews' coefficent | 2.20 | Rfactor | 0.20213 | | Waters | 125 | Solvent Content | 44.70 |
| Ligand Information | | Ligands | | | Metals | | | |
