| Title | Targeting tuberculosis and malaria through inhibition of Enoyl reductase: compound activity and structural data. J.Biol.Chem. 278 20851-20859 2003 | | Site | TBSGC | | PDB Id | | Target Id | Rv1484 | | Related PDB Ids 1enz 1eny 1bvr 1zid 1p45 2aq8 2b35 2b36 2b37 2h7i 2h7l 2h7m 2h7n 2h7p 2nv6 | | Molecular Characteristics | | Source | | | Alias Ids | TPS9461,15608622, P0A5Y6, 15608622, NP_216000.1 | Molecular Weight | 28526.21 Da. | | Residues | 269 | Isoelectric Point | 5.73 | | Sequence | mtglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakaplleldvqnee hlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgihisaysyasmakallpim npggsivgmdfdpsrampaynwmtvaksalesvnrfvareagkygvrsnlvaagpirtlamsaivggal geeagaqiqlleegwdqrapigwnmkdatpvaktvcallsdwlpattgdiiyadggahtqll | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 6 | | Resolution (Å) | 2.70 | Rfree | 0.288 | | Matthews' coefficent | 2.35 | Rfactor | 0.19 | | Waters | 147 | Solvent Content | 47.61 |
| Ligand Information | | Ligands | NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 6;GEQ (5-{[4-(9H-FLUOREN-9-YL)PIPERAZIN-1-YL]CARBONYL}-1H-) x 4 | | Metals | | | |
