| Title | Solution structure of the Mycobacterium tuberculosis complex protein MPB70: from tuberculosis pathogenesis to inherited human corneal desease. J.Biol.Chem. 278 43736-43743 2003 | | Site | TBSGC | | PDB Id | | Target Id | Rv2875 | | Molecular Characteristics | | Source | | | Alias Ids | TPS20709,15610012, P0A668, 15610012, NP_217391.1 | Molecular Weight | 19071.42 Da. | | Residues | 193 | Isoelectric Point | 4.75 | | Sequence | mkvkntiaatsfaaaglaalavavsppaaagdlvgpgcaeyaaanptgpasvqgmsqdpvavaasnnpe lttltaalsgqlnpqvnlvdtlnsgqytvfaptnaafsklpastidelktnsslltsiltyhvvagqts panvvgtrqtlqgasvtvtgqgnslkvgnadvvcggvstanatvymidsvlmppa | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
