| Title | Structure of Mycobacterium tuberculosis Methionine Sulfoxide Reductase A in Complex with Protein-bound Methionine. J.Bacteriol. 185 4119-4126 2003 | | Site | TBSGC | | PDB Id | | Target Id | Rv0137c | | Molecular Characteristics | | Source | | | Alias Ids | TPS20595,15607279, P0A5L0, 15607279, NP_214651.1 | Molecular Weight | 20483.70 Da. | | Residues | 182 | Isoelectric Point | 5.71 | | Sequence | mtsnqkailaggcfwglqdlirnqpgvvstrvgysggnipnatyrnhgthaeaveiifdptvtdyrtll efffqihdpttkdrqgndrgtsyrsaifyfdeqqkrialdtiadveasglwpgkvvtevspagdfweae pehqdylqrypngytchfvrpgwrlprrtaesalraslspelgt | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.50 | Rfree | 0.177 | | Matthews' coefficent | 2.12 | Rfactor | 0.16 | | Waters | 231 | Solvent Content | 41.52 |
| Ligand Information | | Ligands | | | Metals | | | |
