| Title | Crystal structure of a major secreted protein of Mycobacterium tuberculosis-MPT63 at 1.5-A resolution. 2002 | | Site | SGC | | PDB Id | | Target Id | Rv1926c | | Molecular Characteristics | | Source | Mycobacterium tuberculosis h37rv | | Alias Ids | TPS20662,15609063, P0A5Q2, NP_216442.1 | Molecular Weight | 16513.11 Da. | | Residues | 159 | Isoelectric Point | 4.92 | | Sequence | mklttmiktavavvamaaiatfaapvalaaypitgklgseltmtdtvgqvvlgwkvsdlksstavipgyp vagqvweatatvnairgsvtpavsqfnartadginyrvlwqaagpdtisgatipqgeqstgkiyfdvtg psptivamnngmedlliwep | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.50 | Rfree | 0.2524 | | Matthews' coefficent | 1.65 | Rfactor | 0.197 | | Waters | 172 | Solvent Content | 25.60 |
| Ligand Information | | Ligands | | | Metals | | | |
