| Title | An interfacial mechanism and a class of inhibitors inferred from two crystal structures of the Mycobacterium tuberculosis 30 kDa major secretory protein (Antigen 85B), a mycolyl transferase. J.Mol.Biol. 307 671-681 2001 | | Site | TBSGC | | PDB Id | | Target Id | Rv1886c | | Related PDB Ids 1f0p | | Molecular Characteristics | | Source | | | Alias Ids | TPS20649,15609023, P31952, 15609023, NP_216402.1 | Molecular Weight | 34578.97 Da. | | Residues | 325 | Isoelectric Point | 5.62 | | Sequence | mtdvsrkirawgrrlmigtaaavvlpglvglaggaatagafsrpglpveylqvpspsmgrdikvqfqsg gnnspavylldglraqddyngwdintpafewyyqsglsivmpvggqssfysdwyspacgkagcqtykwe tfltselpqwlsanravkptgsaaiglsmagssamilaayhpqqfiyagslsalldpsqgmgpsligla mgdaggykaadmwgpssdpawerndptqqipklvanntrlwvycgngtpnelgganipaeflenfvrss nlkfqdaynaagghnavfnfppngthsweywgaqlnamkgdlqsslgag | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.80 | Rfree | 0.276 | | Matthews' coefficent | 2.33 | Rfactor | 0.1941 | | Waters | 205 | Solvent Content | 46.90 |
| Ligand Information | | Ligands | MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 1;MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 3 | | Metals | | | |
