| Title | Crystal structure of Mycobacterium tuberculosis 7,8-dihydropteroate synthase in complex with pterin monophosphate: new insight into the enzymatic mechanism and sulfa-drug action. J.Mol.Biol. 302 1193-1212 2000 | | Site | TBSGC | | PDB Id | | Target Id | Rv3608c | | Molecular Characteristics | | Source | | | Alias Ids | TPS27504,57117134, P0A578, 57117134, YP_177997.1 | Molecular Weight | 28841.29 Da. | | Residues | 280 | Isoelectric Point | 5.08 | | Sequence | mspapvqvmgvlnvtddsfsdggcyldlddavkhglamaaagagivdvggessrpgatrvdpavetsrv ipvvkelaaqgitvsidtmradvaraalqngaqmvndvsggradpamgpllaeadvpwvlmhwravsad tphvpvrygnvvaevradllasvadavaagvdparlvldpglgfaktaqhnwailhalpelvatgipvl vgasrkrflgallagpdgvmrptdgrdtatavisalaalhgawgvrvhdvrasvdaikvveawmgaeri erdg | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.70 | Rfree | 0.2430000 | | Matthews' coefficent | 2.40 | Rfactor | 0.1850000 | | Waters | 244 | Solvent Content | 48.74 |
| Ligand Information | | Ligands | PMM (PTERIN-6-YL-METHYL-MONOPHOSPHATE) x 1 | | Metals | MG (MAGNESIUM) x 1 | | |
