| Title | Crystal structure of the secreted form of antigen 85C reveals potential targets for mycobacterial drugs and vaccines. Nat.Struct.Biol. 7 141-146 2000 | | Site | TBSGC | | PDB Id | | Target Id | Rv0129c | | Related PDB Ids 1dqz 1va5 | | Molecular Characteristics | | Source | | | Alias Ids | TPS9424,57116693, P0A4V4, 57116693, YP_177694.1 | Molecular Weight | 36769.33 Da. | | Residues | 340 | Isoelectric Point | 5.92 | | Sequence | mtffeqvrrlrsaattlprrlaiaamgavlvyglvgtfggpatagafsrpglpveylqvpsasmgrdik vqfqgggphavylldglraqddyngwdintpafeeyyqsglsvimpvggqssfytdwyqpsqsngqnyt ykwetfltrempawlqankgvsptgnaavglsmsggsalilaayypqqfpyaaslsgflnpsegwwptl iglamndsggynansmwgpssdpawkrndpmvqiprlvanntriwvycgngtpsdlggdnipakflegl tlrtnqtfrdtyaadggrngvfnfppngthswpywneqlvamkadiqhvlngatppaapaapaa | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.83 | Rfree | 0.1887 | | Matthews' coefficent | 2.71 | Rfactor | 0.1684 | | Waters | 292 | Solvent Content | 54.63 |
| Ligand Information | | Ligands | DEP (DIETHYL) x 1;MRD ((4R)-2-METHYLPENTANE-2,4-DIOL) x 2 | | Metals | | | |
