| Title | Crystal structure of peptidyl-prolyl cis-trans isomerase from Encephalitozoon cuniculi at 1.9 A resolution. To be published | | Site | SSGCID | | PDB Id | | Target Id | EncuA.00682.a | | Molecular Characteristics | | Source | Encephalitozoon cuniculi | | Alias Ids | TPS31931, | Molecular Weight | 19045.62 Da. | | Residues | 172 | Isoelectric Point | 6.59 | | Sequence | makeasgnvyfdvyaneeslgrivmkleddivpktaknfrtlcerpkgegykgstfhriipgfmvqggdy tahngtggrsiygekfpdenfelkhtkegilsmancgahtngsqffitlgktqwldekhvvfgevvegm dvvhkiakygsesgqvkkgyrieirdcgvlgsn | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 1.95 | Rfree | 0.216 | | Matthews' coefficent | 2.09 | Rfactor | 0.163 | | Waters | 438 | Solvent Content | 41.28 |
| Ligand Information | | Ligands | PG5 (1-METHOXY-2-[2-(2-METHOXY-ETHOXY]-ETHANE) x 2;EDO (1,2-ETHANEDIOL) x 2;SO4 (SULFATE) x 2 | | Metals | | | |
