| Title | Crystal Structure of the putative Carbonyl Reductase Sniffer of Caenorhabditis elegans. To be Published | | Site | SECSG | | PDB Id | | Target Id | C55A6.5 | | Molecular Characteristics | | Source | Caenorhabditis elegans | | Alias Ids | TPS9293, | Molecular Weight | 26701.12 Da. | | Residues | 250 | Isoelectric Point | 8.85 | | Sequence | mspgsvvvtganrgiglglvqqlvkdknirhiiatardvekatelksikdsrvhvlpltvtcdksldtf vskvgeivgsdglsllinnagvllsygtntepnraviaeqldvnttsvvlltqkllpllknaaskesgd qlsvsraavitissglgsitdntsgsaqfpvlayrmskaainmfgrtlavdlkddnvlvvnfcpgwvqt nlggknaaltveqstaelissfnkldnshngrffmrnlkpyef | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 6 | | Resolution (Å) | 2.60 | Rfree | 0.286 | | Matthews' coefficent | 2.40 | Rfactor | 0.218 | | Waters | 236 | Solvent Content | 48.80 |
| Ligand Information | | Ligands | | | Metals | | | |
