| Title | Conserved hypothetical protein Pfu-838710-001 from Pyrococcus furiosus. To be published | | Site | SECSG | | PDB Id | | Target Id | Pfu-838710-001 | | Molecular Characteristics | | Source | Pyrococcus furiosus | | Alias Ids | TPS9298, | Molecular Weight | 20416.41 Da. | | Residues | 171 | Isoelectric Point | 4.93 | | Sequence | meveikfkikledflhtlntfnpefvryeeqedvyfevprpkllrirgvhnlkkyyltfkeildennee fyevefeigdfekavevfkrlgfkiqatikkkrwvyklngvtlevnrvegigdfvdievisdspeeake kiwevakmlglkeedveprlylelinelsgrss | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.30 | Rfree | 0.2578 | | Matthews' coefficent | 4.05 | Rfactor | 0.2228 | | Waters | 17 | Solvent Content | 69.59 |
| Ligand Information | | Ligands | UNX (UNKNOWN) x 7 | | Metals | PT (PLATINUM) x 1 | | |
