| Title | Conserved hypothetical protein Pfu-1806301-001 from Pyrococcus furiosus. To be published | | Site | SECSG | | PDB Id | | Target Id | Pfu-1806301-001 | | Molecular Characteristics | | Source | Pyrococcus furiosus | | Alias Ids | TPS9342, | Molecular Weight | 7969.88 Da. | | Residues | 71 | Isoelectric Point | 4.62 | | Sequence | mgmesllekvlkewkghkvavsvggdhsftgtledfdeevillkdvvdvignrgkqmligledinwiml le | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 2.80 | Rfree | 0.311 | | Matthews' coefficent | 2.89 | Rfactor | 0.281 | | Waters | | Solvent Content | 57.37 |
| Ligand Information | | Ligands | | | Metals | | | |
