| Title | Conserved hypothetical protein from Pyrococcus furiosus Pfu-1581948-001. To be published | | Site | SECSG | | PDB Id | | Target Id | Pfu-1581948-001 | | Molecular Characteristics | | Source | Pyrococcus furiosus | | Alias Ids | TPS9322, | Molecular Weight | 9070.28 Da. | | Residues | 76 | Isoelectric Point | 9.57 | | Sequence | mttlkllrkeidkidnqiisllkkrleiaqaigkikkelnlpiedrkreeevlrragefreifekilev skdvqrl | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.82 | Rfree | 0.2366 | | Matthews' coefficent | 2.54 | Rfactor | 0.2009 | | Waters | 61 | Solvent Content | 51.63 |
| Ligand Information | | Ligands | UNX (UNKNOWN) x 3 | | Metals | | | |
