| Title | Conserved hypothetical protein Cth-95 from Clostridium thermocellum. To be published | | Site | SECSG | | PDB Id | | Target Id | Cth-95 | | Molecular Characteristics | | Source | Clostridium thermocellum | | Alias Ids | TPS9301, | Molecular Weight | 20652.62 Da. | | Residues | 185 | Isoelectric Point | 5.48 | | Sequence | misagdfkngvtfeldgqifqviefqhvkpgkgaafvrtklknivtgatiektfnptdkmpkahierkd mqylyndgdlyyfmdtetfeqlplgkdkigdalkfvkeneivkvlshkgnvfgieppnfvelevtdtep gfkgdtatgatkpaivetgasikvplfvnkgdiiridtrtgeymerv | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.95 | Rfree | 0.2704 | | Matthews' coefficent | 2.50 | Rfactor | 0.2275 | | Waters | 198 | Solvent Content | 50.85 |
| Ligand Information | | Ligands | UNX (UNKNOWN) x 5 | | Metals | | | |
