| Title | Conserved hypothetical protein Cth-383 from Clostridium thermocellum. To be published | | Site | SECSG | | PDB Id | | Target Id | Cth-383 | | Molecular Characteristics | | Source | Clostridium thermocellum | | Alias Ids | TPS9343, | Molecular Weight | 11995.20 Da. | | Residues | 113 | Isoelectric Point | 4.87 | | Sequence | makggfpgfggninnlvkqaqkmqrdmervqeelkektveasagggavtvvatgrkdikeitikpevvd pddvemlqdlilaavnealrkademvtaeiskitgglggipglf | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.80 | Rfree | 0.2564 | | Matthews' coefficent | | Rfactor | 0.2246 | | Waters | 90 | Solvent Content | |
| Ligand Information | | Ligands | UNX (UNKNOWN) x 4 | | Metals | | | |
