| Title | Conserved hypothetical protein Pfu-178653-001 from Pyrococcus furiosus. To be published | | Site | SECSG | | PDB Id | | Target Id | Pfu-178653-001 | | Molecular Characteristics | | Source | Pyrococcus furiosus | | Alias Ids | TPS9349, | Molecular Weight | 19941.64 Da. | | Residues | 167 | Isoelectric Point | 4.55 | | Sequence | mmlkevhellnriwgdifelreelkeelkgftveevsevfnaylyidgkweemkyphpafavkpggevg atpqgfyfvfafpkeelskefiedvirafeklfiygaenfledfynfehpisgdevwdrivnsdeemin fevdlgfdkeevkreikrfielarrynll | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.60 | Rfree | 0.2291 | | Matthews' coefficent | 2.79 | Rfactor | 0.2039 | | Waters | 102 | Solvent Content | 55.96 |
| Ligand Information | | Ligands | UNX (UNKNOWN) x 1 | | Metals | | | |
