| Title | Conserved hypothetical protein Pfu-367848-001 from Pyrococcus furiosus. To be published | | Site | SECSG | | PDB Id | | Target Id | Pfu-367848-001 | | Molecular Characteristics | | Source | Pyrococcus furiosus | | Alias Ids | TPS9320, | Molecular Weight | 17152.43 Da. | | Residues | 149 | Isoelectric Point | 5.28 | | Sequence | mplppditfdslalikmhsqsmkkileitlakftvnlsivtvyryltvraylkknieleldvlkdiyni vplneeiaikaaqieadlmrkgmmpdiedvltaataiytksllitddskryepmrrfgldtmpldkfvk evelmvekeli | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.30 | Rfree | 0.2779 | | Matthews' coefficent | 2.11 | Rfactor | 0.2216 | | Waters | 39 | Solvent Content | 41.61 |
| Ligand Information | | Ligands | UNX (UNKNOWN) x 42 | | Metals | | | |
