| Title | Conserved hypothetical protein Pfu-723267-001 from Pyrococcus furiosus. To be published | | Site | SECSG | | PDB Id | | Target Id | Pfu-723267-001 | | Molecular Characteristics | | Source | Pyrococcus furiosus | | Alias Ids | TPS9360, | Molecular Weight | 14680.43 Da. | | Residues | 130 | Isoelectric Point | 8.83 | | Sequence | mnskefrkialvgasknpakygniilkdllskgfevlpvnpnydeieglkcyrsvrelpkdvdvivfvv ppkvglqvakeaveagfkklwfqpgaeseeirrflekagveysfgrcimvetsnkkiflev | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.70 | Rfree | 0.245 | | Matthews' coefficent | 2.10 | Rfactor | 0.2226 | | Waters | 23 | Solvent Content | 41.44 |
| Ligand Information | | Ligands | SCN (THIOCYANATE) x 1;COA (COENZYME) x 1;UNX (UNKNOWN) x 6;UNX-UNX (UNKNOWN) x 1 | | Metals | | | |
