| Title | Conserved hypothetical protein from Pyrococcus furiosus Pfu-403030-001. To be published | | Site | SECSG | | PDB Id | | Target Id | Pfu-403030-001 | | Molecular Characteristics | | Source | Pyrococcus furiosus | | Alias Ids | TPS9313, | Molecular Weight | 20176.35 Da. | | Residues | 176 | Isoelectric Point | 4.99 | | Sequence | midlillagklkriprmgwlikgvpnpesvadhsyrvafitlllaeelkkkgveidvekalkiaiihdl geaiitdlplsaqkylnkeeaeakalkdvlpeytelfeeyskaltlegqlvkiadkldmiiqayeyels gaknlsefwnaledlekleisrylreiieevrrlkddh | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 3 | | Resolution (Å) | 2.26 | Rfree | 0.2462 | | Matthews' coefficent | 2.71 | Rfactor | 0.1995 | | Waters | 69 | Solvent Content | 54.68 |
| Ligand Information | | Ligands | UNX (UNKNOWN) x 19 | | Metals | NI (NICKEL) x 6 | | |
