| Title | Conserved hypothetical protein from Clostridium thermocellum Cth-2968. To be published | | Site | SECSG | | PDB Id | | Target Id | Cth-2968 | | Molecular Characteristics | | Source | Clostridium thermocellum | | Alias Ids | TPS9340, | Molecular Weight | 13669.04 Da. | | Residues | 126 | Isoelectric Point | 5.20 | | Sequence | myievvktnkapeaigpysqaivtgsfvytsgqipinpqtgevvdggieeqakqvlenlknvleaagss lnkvvkttvfikdmdsfakvnevyakyfsepyparscvevsklpkgvlieieavaik | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.20 | Rfree | 0.2248 | | Matthews' coefficent | 2.51 | Rfactor | 0.1925 | | Waters | 57 | Solvent Content | 50.94 |
| Ligand Information | | Ligands | UNX (UNKNOWN) x 17 | | Metals | | | |
