| Title | HIT family hydrolase from Clostridium thermocellum Cth-393. To be published | | Site | SECSG | | PDB Id | | Target Id | Cth-393 | | Molecular Characteristics | | Source | Clostridium thermocellum | | Alias Ids | TPS9365, | Molecular Weight | 12621.06 Da. | | Residues | 114 | Isoelectric Point | 6.31 | | Sequence | lencvfckiikrelpstiyyederviaikdinpaapvhvliipkehianvkeinesnaqilidihkaan kvaedlgiaekgyrlitncgvaagqtvfhlhyhllggvdmgpkil | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.30 | Rfree | 0.326 | | Matthews' coefficent | 2.72 | Rfactor | 0.2777 | | Waters | 38 | Solvent Content | 54.78 |
| Ligand Information | | Ligands | UNX (UNKNOWN) x 26 | | Metals | | | |
