| Title | Structure of a transcriptional regulator from Clostridium thermocellum Cth-833. To be published | | Site | SECSG | | PDB Id | | Target Id | Cth-833 | | Molecular Characteristics | | Source | Clostridium thermocellum | | Alias Ids | TPS9345, | Molecular Weight | 13415.56 Da. | | Residues | 114 | Isoelectric Point | 7.89 | | Sequence | vissdvirgyvdtiilslliegdsygyeiskniriktdelyvikettlysafarlekngyiksyygeet qgkrrtyyritpegikyykqkceeweltkkvinkfvkelesngdn | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.30 | Rfree | 0.26676 | | Matthews' coefficent | 1.80 | Rfactor | 0.20534 | | Waters | 40 | Solvent Content | 31.81 |
| Ligand Information | | Ligands | UNX (UNKNOWN) x 13 | | Metals | HG (MERCURY) x 4 | | |
