| Title | Away from the edge II: in-house Se-SAS phasing with chromium radiation. Acta Crystallogr.,Sect.D 61 960-966 2005 | | Site | SECSG | | PDB Id | | Target Id | Cth-682 | | Molecular Characteristics | | Source | Clostridium thermocellum | | Alias Ids | TPS9351, | Molecular Weight | 13095.45 Da. | | Residues | 118 | Isoelectric Point | 4.95 | | Sequence | mvwairgattvsdntadeivaetqkllkemaekngleeddiisiiftvtkdldaafpaiaarnmgwtst almcmneidvpgslekcirvmmhvntdkdkkdikhvylngakvlrpdlt | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 3 | | Resolution (Å) | 2.20 | Rfree | 0.255 | | Matthews' coefficent | | Rfactor | 0.194 | | Waters | 63 | Solvent Content | |
| Ligand Information | | Ligands | UNX (UNKNOWN) x 2 | | Metals | | | |
