| Title | Conserved hypothetical protein Pfu-877259-001 from Pyrococcus furiosus. To be published | | Site | SECSG | | PDB Id | | Target Id | Pfu-877259-001 | | Molecular Characteristics | | Source | Pyrococcus furiosus | | Alias Ids | TPS9304, | Molecular Weight | 28343.82 Da. | | Residues | 242 | Isoelectric Point | 9.36 | | Sequence | mrelveiikgigiegakeveekvdrqfyalqylfrhqdpemfiklvianslvsyqltgrgedwwwefar yfsgrevdsiwkaygeflpksknnrrlieaklnrirkvegflstltlkdlegyyknmkmlwkalikimg sredsktivftvkmfgyasriafsrfipypmeipipedlriksvtskltqekptkfwmkigqesgvppl hidsliwpllgnadltpldielrnklmkltellgl | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.88 | Rfree | 0.261 | | Matthews' coefficent | 2.13 | Rfactor | 0.207 | | Waters | 133 | Solvent Content | 42.38 |
| Ligand Information | | Ligands | | | Metals | | | |
